| Name | O_BomaASG13445_internal:A_BomaASG_c30239_g1_i3 |
| Scaffold_id | |
NCBI non-redundant (nr) | crossover_junction_endonuclease_EME1_isoform_X2_[Bombyx_mori] |
| Ontology |
| GO:0000790 |
C |
chromatin |
| GO:0003677 |
F |
DNA binding |
| GO:0004518 |
F |
nuclease activity |
| GO:0004519 |
F |
endonuclease activity |
| GO:0004520 |
F |
endodeoxyribonuclease activity |
| GO:0005515 |
F |
protein binding |
| GO:0005634 |
C |
nucleus |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005720 |
C |
heterochromatin |
| GO:0005730 |
C |
nucleolus |
| GO:0005737 |
C |
cytoplasm |
| GO:0006281 |
P |
DNA repair |
| GO:0006310 |
P |
DNA recombination |
| GO:0006974 |
P |
cellular response to DNA damage stimulus |
| GO:0016787 |
F |
hydrolase activity |
| GO:0036297 |
P |
interstrand cross-link repair |
| GO:0046872 |
F |
metal ion binding |
| GO:0072429 |
P |
response to intra-S DNA damage checkpoint signaling |
| GO:0090305 |
P |
nucleic acid phosphodiester bond hydrolysis |
|
| RNA-seq Entry | A_BomaASG_c30239_g1_i3 |
Sequence (Amino Acid) | APDRSALALLIVQHTKAIAEAPYKMSKRVYDEQSDLYLRGENRKCVTVDKQGNGVSRLWQ
QMIAVLPHSSLETSRALCAKYPTPLDLYESLNSPDSVNELANIGVSRTAVPGSKARRIGP
EFARKLHTLFTATDG
(44 a.a.) |