SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG13398_5prime_partial:A_BomaASG_c30215_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
serine/threonine_kinase_LKB1_isoform_X1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0001558 P regulation of cell growth
GO:0001894 P tissue homeostasis
GO:0001944 P vasculature development
GO:0002039 F p53 binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0006914 P autophagy
GO:0006915 P apoptotic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007050 P regulation of cell cycle
GO:0007283 P spermatogenesis
GO:0007286 P spermatid development
GO:0007409 P axonogenesis
GO:0008285 P negative regulation of cell population proliferation
GO:0010212 P response to ionizing radiation
GO:0010508 P positive regulation of autophagy
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0030010 P establishment of cell polarity
GO:0030111 P regulation of Wnt signaling pathway
GO:0030154 P cell differentiation
GO:0030275 F LRR domain binding
GO:0030295 F protein kinase activator activity
GO:0030308 P negative regulation of cell growth
GO:0030511 P positive regulation of transforming growth factor beta receptor signaling pathway
GO:0032147 P activation of protein kinase activity
GO:0036398 C TCR signalosome
GO:0036399 P TCR signalosome assembly
GO:0042593 P glucose homeostasis
GO:0043276 P anoikis
GO:0045059 P positive thymic T cell selection
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0048814 P regulation of dendrite morphogenesis
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0050772 P positive regulation of axonogenesis
GO:0050852 P T cell receptor signaling pathway
GO:0051055 P negative regulation of lipid biosynthetic process
GO:0051645 P Golgi localization
GO:0051896 P regulation of protein kinase B signaling
GO:0060070 P canonical Wnt signaling pathway
GO:0060770 P negative regulation of epithelial cell proliferation involved in prostate gland development
GO:0070062 C extracellular exosome
GO:0071493 P cellular response to UV-B
GO:0071902 P positive regulation of protein serine/threonine kinase activity
GO:0072332 P intrinsic apoptotic signaling pathway by p53 class mediator
GO:0097484 P dendrite extension
GO:1900182 P positive regulation of protein localization to nucleus
GO:1901796 P regulation of signal transduction by p53 class mediator
GO:1904262 P negative regulation of TORC1 signaling
RNA-seq EntryA_BomaASG_c30215_g1_i1
Sequence
(Amino Acid)
NVQREIQLLRILRHKNVIELVDVIYNDEKQKMYLVMEFCVGVLQDMLESSPGKKFPQRQA
HDYFLQLLDGLDYLHGQGVVHKDIKPGNLLLTLDQTLKITDFGVAEALDMFSQEDICYTG
QGSPAFQPPEIANGAEQFSGTKVDIWSSGVTLYNMTTGRYPFEGDNVYRLLEAISRGPPA
PPPASVGPALSALLVHMLNRDPTLRPTVHEIRRHAWVQATPPFEPGEKLVNPRSRRSDEL
HTSTVIPYLVERHYASAQEYFTERDLRQGLGDGGSRTMSTAELSDGGSGQHKRRWHSSCG
RLPSCRLT
*(102 a.a.)

- SilkBase 1999-2023 -