SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG1329_internal:A_BomaASG_c9250_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		apoptosis-stimulating_of_p53_protein_1_[Bombyx_mori]
Ontology
GO:0002039 F p53 binding
GO:0005070 F obsolete SH3/SH2 adaptor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0006915 P apoptotic process
GO:0007049 P cell cycle
GO:0007165 P signal transduction
GO:0017124 F SH3 domain binding
GO:0042802 F identical protein binding
GO:0042981 P regulation of apoptotic process
GO:0045786 P negative regulation of cell cycle
GO:0048471 C perinuclear region of cytoplasm
GO:0051059 F NF-kappaB binding
GO:0072332 P intrinsic apoptotic signaling pathway by p53 class mediator
GO:1900119 P positive regulation of execution phase of apoptosis
GO:1900740 P positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
GO:1901216 P positive regulation of neuron death
GO:1901796 P regulation of signal transduction by p53 class mediator
RNA-seq EntryA_BomaASG_c9250_g1_i2
Sequence
(Amino Acid)
ESHPLTIRKPPMSEQPKLRNLNPKNGISVSINRRIEMPPAFLFPEMDHLNIDTENGLKEK
TKQKDEVDRSVSDKEDSKDNVIVSDITEQISSVDLNGQESSDNVLRRVKKGNLKQGGKAP
LARRVSFDPLALLLDASLEGELELVKKTATQVQNASAANDEGITAPHNAICA
(56 a.a.)

- SilkBase 1999-2023 -