SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG13292_internal:A_BomaASG_c30165_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
lethal(2)_giant_larvae_protein_isoform_X5_[Bombyx_mori]
Ontology
GO:0000137 C Golgi cis cisterna
GO:0000139 C Golgi membrane
GO:0005096 F GTPase activator activity
GO:0005198 F structural molecule activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005794 C Golgi apparatus
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0006461 P protein-containing complex assembly
GO:0006887 P exocytosis
GO:0006893 P Golgi to plasma membrane transport
GO:0007409 P axonogenesis
GO:0008593 P regulation of Notch signaling pathway
GO:0016020 C membrane
GO:0017137 F small GTPase binding
GO:0017157 P regulation of exocytosis
GO:0019901 F protein kinase binding
GO:0019905 F syntaxin binding
GO:0022008 P neurogenesis
GO:0030424 C axon
GO:0030864 C cortical actin cytoskeleton
GO:0030866 P cortical actin cytoskeleton organization
GO:0031901 C early endosome membrane
GO:0032588 C trans-Golgi network membrane
GO:0032878 P regulation of establishment or maintenance of cell polarity
GO:0042995 C cell projection
GO:0043547 P positive regulation of GTPase activity
GO:0050708 P regulation of protein secretion
GO:0051294 P establishment of spindle orientation
RNA-seq EntryA_BomaASG_c30165_g1_i1
Sequence
(Amino Acid)
IGRAYPTSPTQPIPKKPIDKAASETDAEIKPIERAVEARSTDDAYGSMVRCLYFARTFLI
NTQQSTPTLWAGTNNGTVYAFTLHVPNTNKRKEEPVTCQLAKEIQLKHRAPVIGITVLDG
ASVPLPDPLEVERGVSPLPEPGTHRVVITSEEQFKIFTLPSLKPHNKYKLTAHEGARVRR
TAWSQFSCGAHREWCLLCLTNLGDCLVLSPELRRQLNAAAVRKERS
(74 a.a.)

- SilkBase 1999-2023 -