SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG1320_5prime_partial:A_BomaASG_c9194_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		catenin_delta-2_isoform_X3_[Bombyx_mori]
Ontology
GO:0000922 C spindle pole
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0007043 P cell-cell junction assembly
GO:0007155 P cell adhesion
GO:0007267 P cell-cell signaling
GO:0009898 C cytoplasmic side of plasma membrane
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0016337 P cell-cell adhesion
GO:0030054 C cell junction
GO:0030057 C desmosome
GO:0030155 P regulation of cell adhesion
GO:0030496 C midbody
GO:0032467 P positive regulation of cytokinesis
GO:0043547 P positive regulation of GTPase activity
GO:0044291 C cell-cell contact zone
GO:0048471 C perinuclear region of cytoplasm
GO:0051233 C spindle midzone
GO:0072686 C mitotic spindle
RNA-seq EntryA_BomaASG_c9194_g1_i1
Sequence
(Amino Acid)
HRHTPRVLKFAGQVLMTMWSHAELREVYRKHGWREADFLTPARAAQQRSSSGSSAGPGAA
SGAPHSPGHANSTLSRPMASTGGTRYEDRTIRRHRENDDVPPMDANNYQEGIGMGNPNGR
PMNLQGVQAQMPMPPSSR
*(45 a.a.)

- SilkBase 1999-2023 -