SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG13201_internal:A_BomaASG_c30122_g2_i1
Scaffold_id
NCBI non-redundant
(nr)
protein_argonaute-2_isoform_X2_[Helicoverpa_armigera]
Ontology
GO:0000340 F RNA 7-methylguanosine cap binding
GO:0000932 C P-body
GO:0003674 F molecular_function
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0005575 C cellular_component
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005844 C polysome
GO:0005845 C mRNA cap binding complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006417 P regulation of translation
GO:0008150 P biological_process
GO:0016442 C RISC complex
GO:0016787 F hydrolase activity
GO:0016891 F endoribonuclease activity, producing 5'-phosphomonoesters
GO:0030154 P cell differentiation
GO:0030529 C ribonucleoprotein complex
GO:0031047 P gene silencing by RNA
GO:0031054 P pre-miRNA processing
GO:0035068 C RISC complex
GO:0035197 F siRNA binding
GO:0035198 F miRNA binding
GO:0035278 P miRNA-mediated gene silencing by inhibition of translation
GO:0035279 P miRNA-mediated gene silencing by mRNA destabilization
GO:0045947 P negative regulation of translational initiation
GO:0046872 F metal ion binding
GO:0060213 P positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:0070551 F endoribonuclease activity, cleaving siRNA-paired mRNA
GO:0070578 C RISC-loading complex
GO:0090502 P RNA phosphodiester bond hydrolysis, endonucleolytic
GO:1900153 P positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
RNA-seq EntryA_BomaASG_c30122_g2_i1
Sequence
(Amino Acid)
VVCVAQVFNEPVIFLGVDVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIV
HEMSSMVQELLIMFYKSTGGFKPHRIIMYRDGISEGQFLHVLQHELTAVREACIKLEAEY
KPGITFIVVQKRHHTRLFCADKKEQSGKSGNIPAGTTVDLGITHPTEFDFYLCSHQGIQ
(58 a.a.)

- SilkBase 1999-2023 -