SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG12968_internal:A_BomaASG_c30030_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
breast_cancer_type_2_susceptibility_protein_homolog_[Bombyx_mori]
Ontology
GO:0000722 P telomere maintenance via recombination
GO:0000724 P double-strand break repair via homologous recombination
GO:0000784 C chromosome, telomeric region
GO:0000910 P cytokinesis
GO:0001556 P oocyte maturation
GO:0001833 P inner cell mass cell proliferation
GO:0002020 F protease binding
GO:0003677 F DNA binding
GO:0003697 F single-stranded DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0006281 P DNA repair
GO:0006289 P nucleotide-excision repair
GO:0006302 P double-strand break repair
GO:0006310 P DNA recombination
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0006978 P DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
GO:0007049 P cell cycle
GO:0007141 P male meiosis I
GO:0007283 P spermatogenesis
GO:0007420 P brain development
GO:0007569 P cell aging
GO:0007584 P response to nutrient
GO:0008283 P cell population proliferation
GO:0008585 P female gonad development
GO:0008630 P intrinsic apoptotic signaling pathway in response to DNA damage
GO:0010165 P response to X-ray
GO:0010225 P response to UV-C
GO:0010332 P response to gamma radiation
GO:0010484 F H3 histone acetyltransferase activity
GO:0010485 F H4 histone acetyltransferase activity
GO:0030097 P hemopoiesis
GO:0030141 C secretory granule
GO:0030879 P mammary gland development
GO:0031052 P chromosome breakage
GO:0031619 P homologous chromosome orientation involved in meiotic metaphase I plate congression
GO:0032355 P response to estradiol
GO:0032465 P regulation of cytokinesis
GO:0033593 C BRCA2-MAGE-D1 complex
GO:0033600 P negative regulation of mammary gland epithelial cell proliferation
GO:0035264 P multicellular organism growth
GO:0042127 P regulation of cell population proliferation
GO:0042771 P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0043009 P chordate embryonic development
GO:0043015 F gamma-tubulin binding
GO:0043234 C protein-containing complex
GO:0043966 P histone H3 acetylation
GO:0043967 P histone H4 acetylation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045931 P positive regulation of mitotic cell cycle
GO:0048478 P replication fork protection
GO:0051276 P chromosome organization
GO:0051298 P centrosome duplication
GO:0070200 P establishment of protein localization to telomere
GO:1990426 P mitotic recombination-dependent replication fork processing
RNA-seq EntryA_BomaASG_c30030_g1_i2
Sequence
(Amino Acid)
QTSKIIEEKKPLVNFKKDYKKTKTYKLKDLCDLEKRYEEKSVAIDYDMDNLMDFIFEKHR
NDVTETVVNVEHVQRIFLSSVNAKLIPKGWLENHIKLILWKLLSYEIKFPNVMANVCTVG
NVIEQLKYRYDKELYNAERPALRKILEKDDVPSKTLVLCVAGIFVDGVEVKSVPKTNNIE
LLVSDGWYSVKATTDGLLARMVRSGKIVVGTKVMTCGAELLNCEGVSPWEDVSSVRLKLS
RSE
(80 a.a.)

- SilkBase 1999-2023 -