| Name | O_BomaASG1283_internal:A_BomaASG_c9121_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | telomere-associated_protein_RIF1_[Bombyx_mori] |
| Ontology |
| GO:0000781 |
C |
chromosome, telomeric region |
| GO:0001939 |
C |
female pronucleus |
| GO:0001940 |
C |
male pronucleus |
| GO:0005515 |
F |
protein binding |
| GO:0005634 |
C |
nucleus |
| GO:0005694 |
C |
chromosome |
| GO:0005737 |
C |
cytoplasm |
| GO:0005819 |
C |
spindle |
| GO:0005856 |
C |
cytoskeleton |
| GO:0005886 |
C |
plasma membrane |
| GO:0006974 |
P |
cellular response to DNA damage stimulus |
| GO:0007049 |
P |
cell cycle |
| GO:0019827 |
P |
stem cell population maintenance |
| GO:2001034 |
P |
positive regulation of double-strand break repair via nonhomologous end joining |
|
| RNA-seq Entry | A_BomaASG_c9121_g1_i1 |
Sequence
(Amino Acid) | LPVVEAAFKIDADNRCRAFQCWSVLIDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEETA
LAKFETWWHLIVKFSTRLGVFTDVVLTSFLHFCFGKYNAS
(32 a.a.) |
