SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG1254_3prime_partial:A_BomaASG_c8989_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
target_of_rapamycin_isoform_1_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0001030 F RNA polymerase III type 1 promoter sequence-specific DNA binding
GO:0001031 F RNA polymerase III type 2 promoter sequence-specific DNA binding
GO:0001032 F RNA polymerase III type 3 promoter sequence-specific DNA binding
GO:0001156 F TFIIIC-class transcription factor complex binding
GO:0001933 P negative regulation of protein phosphorylation
GO:0001934 P positive regulation of protein phosphorylation
GO:0001938 P positive regulation of endothelial cell proliferation
GO:0003007 P heart morphogenesis
GO:0003179 P heart valve morphogenesis
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005979 P regulation of glycogen biosynthetic process
GO:0006109 P regulation of carbohydrate metabolic process
GO:0006112 P energy reserve metabolic process
GO:0006207 P 'de novo' pyrimidine nucleobase biosynthetic process
GO:0006281 P DNA repair
GO:0006468 P protein phosphorylation
GO:0006950 P response to stress
GO:0007281 P germ cell development
GO:0007420 P brain development
GO:0007569 P cell aging
GO:0007616 P long-term memory
GO:0008144 F obsolete drug binding
GO:0008542 P visual learning
GO:0009791 P post-embryonic development
GO:0010507 P negative regulation of autophagy
GO:0010592 P positive regulation of lamellipodium assembly
GO:0010628 P positive regulation of gene expression
GO:0010831 P positive regulation of myotube differentiation
GO:0010942 P positive regulation of cell death
GO:0010976 P positive regulation of neuron projection development
GO:0012505 C endomembrane system
GO:0014042 P positive regulation of neuron maturation
GO:0014736 P negative regulation of muscle atrophy
GO:0016020 C membrane
GO:0016049 P cell growth
GO:0016242 P negative regulation of macroautophagy
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016605 C PML body
GO:0016740 F transferase activity
GO:0016773 F phosphotransferase activity, alcohol group as acceptor
GO:0018105 P peptidyl-serine phosphorylation
GO:0018107 P peptidyl-threonine phosphorylation
GO:0019901 F protein kinase binding
GO:0019904 F protein domain specific binding
GO:0021510 P spinal cord development
GO:0030030 P cell projection organization
GO:0030425 C dendrite
GO:0030838 P positive regulation of actin filament polymerization
GO:0031397 P negative regulation of protein ubiquitination
GO:0031529 P ruffle organization
GO:0031641 P regulation of myelination
GO:0031669 P cellular response to nutrient levels
GO:0031929 P TOR signaling
GO:0031931 C TORC1 complex
GO:0031932 C TORC2 complex
GO:0031998 P regulation of fatty acid beta-oxidation
GO:0032095 P regulation of response to food
GO:0032868 P response to insulin
GO:0032956 P regulation of actin cytoskeleton organization
GO:0032991 C protein-containing complex
GO:0035176 P social behavior
GO:0035264 P multicellular organism growth
GO:0042060 P wound healing
GO:0042220 P response to cocaine
GO:0043022 F ribosome binding
GO:0043025 C neuronal cell body
GO:0043087 P regulation of GTPase activity
GO:0043200 P response to amino acid
GO:0043278 P response to morphine
GO:0043610 P regulation of carbohydrate utilization
GO:0045429 P positive regulation of nitric oxide biosynthetic process
GO:0045670 P regulation of osteoclast differentiation
GO:0045727 P positive regulation of translation
GO:0045792 P negative regulation of cell size
GO:0045859 P regulation of protein kinase activity
GO:0045945 P positive regulation of transcription by RNA polymerase III
GO:0046777 P protein autophosphorylation
GO:0046889 P positive regulation of lipid biosynthetic process
GO:0048255 P mRNA stabilization
GO:0048661 P positive regulation of smooth muscle cell proliferation
GO:0048714 P positive regulation of oligodendrocyte differentiation
GO:0048738 P cardiac muscle tissue development
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0050769 P positive regulation of neurogenesis
GO:0050882 P voluntary musculoskeletal movement
GO:0051219 F phosphoprotein binding
GO:0051496 P positive regulation of stress fiber assembly
GO:0051534 P negative regulation of calcineurin-NFAT signaling cascade
GO:0051896 P regulation of protein kinase B signaling
GO:0051897 P positive regulation of protein kinase B signaling
GO:0055006 P cardiac cell development
GO:0055013 P cardiac muscle cell development
GO:0060048 P cardiac muscle contraction
GO:0060135 P maternal process involved in female pregnancy
GO:0060252 P positive regulation of glial cell proliferation
GO:0060999 P positive regulation of dendritic spine development
GO:0061051 P positive regulation of cell growth involved in cardiac muscle cell development
GO:0071456 P cellular response to hypoxia
GO:0090335 P regulation of brown fat cell differentiation
GO:0090559 P regulation of membrane permeability
GO:1901216 P positive regulation of neuron death
GO:1901838 P positive regulation of transcription of nucleolar large rRNA by RNA polymerase I
GO:1904000 P positive regulation of eating behavior
GO:1904056 P positive regulation of cholangiocyte proliferation
GO:1904058 P positive regulation of sensory perception of pain
GO:1904193 P negative regulation of cholangiocyte apoptotic process
GO:1904197 P positive regulation of granulosa cell proliferation
GO:1904206 P positive regulation of skeletal muscle hypertrophy
GO:1904213 P negative regulation of iodide transmembrane transport
RNA-seq EntryA_BomaASG_c8989_g1_i1
Sequence
(Amino Acid)
MKISDKGDNMTNHQVLELISGLKSRHSETRHRAVRELLHFAKTELREMSQDSLTQILDDF
NQQIHDMTTSYDNNEKKAGILTIVCLIGGDTETTKTRTIRYANYLRNVFPSTDINLLELG
AKTMG
(40 a.a.)

- SilkBase 1999-2023 -