SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG12405_5prime_partial:A_BomaASG_c29672_g3_i1
Scaffold_id
NCBI non-redundant
(nr)		serine_protease_Hayan-like_[Bombyx_mori]
Ontology
GO:0001774 P microglial cell activation
GO:0004252 F serine-type endopeptidase activity
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0006508 P proteolysis
GO:0006935 P chemotaxis
GO:0006954 P inflammatory response
GO:0007205 P protein kinase C-activating G protein-coupled receptor signaling pathway
GO:0008201 F heparin binding
GO:0008233 F peptidase activity
GO:0008347 P glial cell migration
GO:0010628 P positive regulation of gene expression
GO:0010800 P positive regulation of peptidyl-threonine phosphorylation
GO:0015643 F toxic substance binding
GO:0016020 C membrane
GO:0016485 P protein processing
GO:0019730 P antimicrobial humoral response
GO:0019898 C extrinsic component of membrane
GO:0035577 C azurophil granule membrane
GO:0035584 P calcium-mediated signaling using intracellular calcium source
GO:0042117 P monocyte activation
GO:0042535 P positive regulation of tumor necrosis factor production
GO:0042582 C azurophil granule
GO:0042742 P defense response to bacterium
GO:0043066 P negative regulation of apoptotic process
GO:0043114 P regulation of vascular permeability
GO:0043395 F heparan sulfate proteoglycan binding
GO:0045123 P cellular extravasation
GO:0045348 P positive regulation of MHC class II biosynthetic process
GO:0045785 P positive regulation of cell adhesion
GO:0045860 P positive regulation of protein kinase activity
GO:0048246 P macrophage chemotaxis
GO:0050725 P positive regulation of interleukin-1 beta production
GO:0050754 P fractalkine production
GO:0050766 P positive regulation of phagocytosis
GO:0050829 P defense response to Gram-negative bacterium
GO:0050930 P induction of positive chemotaxis
GO:0051607 P defense response to virus
GO:0060326 P cell chemotaxis
GO:0070062 C extracellular exosome
GO:0070528 P protein kinase C signaling
GO:0070944 P neutrophil-mediated killing of bacterium
RNA-seq EntryA_BomaASG_c29672_g3_i1
Sequence
(Amino Acid)
VLFRSDKSLSGHRLHKAYVYNLSTRQCRSTDDTWSLRHLQSGSALLQGGCGRSALCAGVL
WSRNAPCNYCAGTPLLSESLLLGVMSDNQQCGVSCDPQIYVTIAMLRDWLDFIIGNK
*(38 a.a.)

- SilkBase 1999-2023 -