SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG12216_5prime_partial:A_BomaASG_c29555_g1_i3
Scaffold_id
NCBI non-redundant
(nr)		protein_NDRG3_[Bombyx_mori]
Ontology
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005886 C plasma membrane
GO:0005913 C adherens junction
GO:0007165 P signal transduction
GO:0008017 F microtubule binding
GO:0008285 P negative regulation of cell population proliferation
GO:0015630 C microtubule cytoskeleton
GO:0016020 C membrane
GO:0017137 F small GTPase binding
GO:0030330 P DNA damage response, signal transduction by p53 class mediator
GO:0032287 P peripheral nervous system myelin maintenance
GO:0042127 P regulation of cell population proliferation
GO:0043015 F gamma-tubulin binding
GO:0043209 C myelin sheath
GO:0045296 F cadherin binding
GO:0045576 P mast cell activation
GO:0048471 C perinuclear region of cytoplasm
GO:0055038 C recycling endosome membrane
GO:0070062 C extracellular exosome
GO:0071456 P cellular response to hypoxia
GO:0090232 P positive regulation of spindle checkpoint
RNA-seq EntryA_BomaASG_c29555_g1_i3
Sequence
(Amino Acid)
DRKSAPGQEEGSPTLPEDYTYPSMDALASQIDFVLGHFGIRSFIGFGVGAGANILSRYAI
INPQKVDALVLINCTSTQAGWTEWLYQKINTRQLRANGMTQGALDYLMWHHFGRSTEDRN
HDLAQVYKDCFSHVNPVNLSLFIDSYLRRTDLSIARDSNTLKVPVLNVTGALSPHVDDTV
TFNGRLDPAKTSWLSISDSGMVLEEQPSKIAEAFKLFLQGEGYLR
*(74 a.a.)

- SilkBase 1999-2023 -