SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG12205_3prime_partial:A_BomaASG_c29545_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		nuclear_hormone_receptor_E75_isoform_C_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003707 F steroid hormone receptor activity
GO:0004879 F nuclear receptor activity
GO:0004887 F nuclear receptor activity
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0007553 P regulation of ecdysteroid metabolic process
GO:0007591 P molting cycle, chitin-based cuticle
GO:0008270 F zinc ion binding
GO:0010468 P regulation of gene expression
GO:0010906 P regulation of glucose metabolic process
GO:0018990 P ecdysis, chitin-based cuticle
GO:0019730 P antimicrobial humoral response
GO:0020037 F heme binding
GO:0030522 P intracellular receptor signaling pathway
GO:0035075 P response to ecdysone
GO:0043401 P steroid hormone mediated signaling pathway
GO:0043565 F sequence-specific DNA binding
GO:0046872 F metal ion binding
GO:0048477 P oogenesis
RNA-seq EntryA_BomaASG_c29545_g1_i2
Sequence
(Amino Acid)
MQCYPKLSPKREPPEGLYEIEMLPGARRLELPAPPGKEFRAPVLLAGPSLAPTHSVIQCM
RPPPPPPPPPPPRLLKPPSFEEPSSSIPDLEFDGTTVLCRVCGDKASGFHYGVHSCEGCK
GFFRRSIQQKIQYRPCTKNQQCSILRINRNRCQYCRLKKCIAVGMSRDAVRFGRVP
(57 a.a.)

- SilkBase 1999-2023 -