SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG11991_5prime_partial:A_BomaASG_c29428_g2_i2
Scaffold_id
NCBI non-redundant
(nr)
ATP-dependent_RNA_helicase_DHX36_isoform_X1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000781 C chromosome, telomeric region
GO:0001047 F core promoter sequence-specific DNA binding
GO:0001503 P ossification
GO:0002151 F G-quadruplex RNA binding
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003723 F RNA binding
GO:0003725 F double-stranded RNA binding
GO:0004004 F RNA helicase activity
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006396 P RNA processing
GO:0008026 F helicase activity
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0009615 P response to virus
GO:0010501 P RNA secondary structure unwinding
GO:0016787 F hydrolase activity
GO:0032206 P positive regulation of telomere maintenance
GO:0032481 P positive regulation of type I interferon production
GO:0042826 F histone deacetylase binding
GO:0043330 P response to exogenous dsRNA
GO:0044212 F transcription cis-regulatory region binding
GO:0044822 F RNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0051880 F G-quadruplex DNA binding
GO:0070062 C extracellular exosome
RNA-seq EntryA_BomaASG_c29428_g2_i2
Sequence
(Amino Acid)
PEDGSIALHPSSVMANKHNGGLNAQPMCASPGANWLVYWLKRRSTDLFLFDVTLVYSLPL
LFFGELHVSPAAEDPDDCIISIEKISVCCKKETTQLLFEMRSLLDHVLADKIMASSEHSV
KNNAFEEQVLNAVIKLITAEDEGAEYLNSDDDNSESDHSEYETNRRWYR
*(55 a.a.)

- SilkBase 1999-2023 -