SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG11711_internal:A_BomaASG_c29169_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		four_and_a_half_LIM_domains_protein_2_isoform_X3_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001649 P osteoblast differentiation
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005925 C focal adhesion
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0008134 F transcription factor binding
GO:0008270 F zinc ion binding
GO:0009725 P response to hormone
GO:0015629 C actin cytoskeleton
GO:0042802 F identical protein binding
GO:0043066 P negative regulation of apoptotic process
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0055014 P atrial cardiac muscle cell development
GO:0055015 P ventricular cardiac muscle cell development
GO:0060347 P heart trabecula formation
RNA-seq EntryA_BomaASG_c29169_g1_i2
Sequence
(Amino Acid)
CSSDLLYCVRHYSEKLKPRCHACDELIFSGEYTKAMNKDWHSGHFCCWQCDESLTGQRYV
LRDEHPYCIKCYESVFANGCEECNKIIGIDSKDLSYKDKHWHEACFLCAKCRVSLVDKQF
GSKLDKIYCGNCYDAQFASRCDGCGEVFRAGTKKMEYK
(51 a.a.)

- SilkBase 1999-2023 -