SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG11688_3prime_partial:A_BomaASG_c29159_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
nucleosome-remodeling_factor_subunit_NURF301_[Bombyx_mori]
Ontology
GO:0003677 F DNA binding
GO:0005634 C nucleus
GO:0006325 P chromatin organization
GO:0006334 P nucleosome assembly
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007095 P mitotic G2 DNA damage checkpoint signaling
GO:0007275 P multicellular organism development
GO:0008270 F zinc ion binding
GO:0010468 P regulation of gene expression
GO:0016568 P chromatin organization
GO:0016589 C NURF complex
GO:0016922 F nuclear receptor binding
GO:0019233 P sensory perception of pain
GO:0030097 P hemopoiesis
GO:0035064 F methylated histone binding
GO:0035073 P pupariation
GO:0035076 P ecdysone receptor-mediated signaling pathway
GO:0042766 P nucleosome mobilization
GO:0045747 P positive regulation of Notch signaling pathway
GO:0045824 P negative regulation of innate immune response
GO:0046331 P lateral inhibition
GO:0046426 P negative regulation of receptor signaling pathway via JAK-STAT
GO:0046872 F metal ion binding
GO:0048515 P spermatid differentiation
GO:0048813 P dendrite morphogenesis
GO:0070577 F lysine-acetylated histone binding
GO:0070615 F ATP-dependent chromatin remodeler activity
RNA-seq EntryA_BomaASG_c29159_g1_i1
Sequence
(Amino Acid)
MINTPSASRASSPQGSDISRRSTRKRKDRKTHKSKRGGISNSYSKRGYNPQAADYHESEY
HYGSDFGDEYSDKSELEEERGSESSEGSEDGAATDSDFSVSSFSTTSGTPRKTNTITNRP
PSPDPLWLQQGRQIPPLDLPLSSDDLII
(48 a.a.)

- SilkBase 1999-2023 -