SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG1141_internal:A_BomaASG_c7971_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		lachesin_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005918 C septate junction
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007275 P multicellular organism development
GO:0007424 P open tracheal system development
GO:0016020 C membrane
GO:0016331 P morphogenesis of embryonic epithelium
GO:0019898 C extrinsic component of membrane
GO:0019991 P septate junction assembly
GO:0031225 C anchored component of membrane
GO:0035151 P regulation of tube size, open tracheal system
GO:0035160 P maintenance of epithelial integrity, open tracheal system
GO:0042803 F protein homodimerization activity
GO:0061343 P cell adhesion involved in heart morphogenesis
RNA-seq EntryA_BomaASG_c7971_g1_i1
Sequence
(Amino Acid)
ANGIPPTKSRRYEVTVLFEPIVRVASPVVLRSTDMQVTLQCYVESSPKSLNTWQRGKSHN
SGKLLNSSKYVISEEILNEYALRMNLTITRLKKYDFGDYTCSAVN
(34 a.a.)

- SilkBase 1999-2023 -