SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG11104_internal:A_BomaASG_c28862_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		rho_guanine_nucleotide_exchange_factor_11_[Bombyx_mori]
Ontology
GO:0000910 P cytokinesis
GO:0001558 P regulation of cell growth
GO:0001664 F G protein-coupled receptor binding
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005089 F guanyl-nucleotide exchange factor activity
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006928 P movement of cell or subcellular component
GO:0006941 P striated muscle contraction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007266 P Rho protein signal transduction
GO:0016020 C membrane
GO:0030010 P establishment of cell polarity
GO:0030036 P actin cytoskeleton organization
GO:0035023 P regulation of Rho protein signal transduction
GO:0043065 P positive regulation of apoptotic process
GO:0043547 P positive regulation of GTPase activity
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0051056 P regulation of small GTPase mediated signal transduction
RNA-seq EntryA_BomaASG_c28862_g1_i1
Sequence
(Amino Acid)
PPPPYHTNTQPCADPQRAIISMEEDDSPASDTSTYSGLFSNLRSVRESKARTAVLLNWLL
GERRCACASLLLILTDAYRSASGVTAATLRRWAYEIHSTFLMPNAVLQLNGVDENMANEI
EHILVNEHDKEELVRNVFRKARQKAKEELSSQLSEFQVKRQVGLGTLYGPHDALLERCDL
DKAQELVVVEQVMTSQLRAVSAASPAPAVPAPDR
(70 a.a.)

- SilkBase 1999-2023 -