SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG11086_internal:A_BomaASG_c28846_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		cell_division_cycle_protein_20_homolog_[Bombyx_mori]
Ontology
GO:0000922 C spindle pole
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005680 C anaphase-promoting complex
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005819 C spindle
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0007049 P cell cycle
GO:0007062 P sister chromatid cohesion
GO:0007067 P mitotic cell cycle
GO:0007399 P nervous system development
GO:0008022 F protein C-terminus binding
GO:0008284 P positive regulation of cell population proliferation
GO:0010997 F anaphase-promoting complex binding
GO:0016567 P protein ubiquitination
GO:0019899 F enzyme binding
GO:0030154 P cell differentiation
GO:0031145 P anaphase-promoting complex-dependent catabolic process
GO:0031915 P positive regulation of synaptic plasticity
GO:0040020 P regulation of meiotic nuclear division
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0042826 F histone deacetylase binding
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043234 C protein-containing complex
GO:0048471 C perinuclear region of cytoplasm
GO:0050773 P regulation of dendrite development
GO:0051301 P cell division
GO:0051436 P obsolete negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
GO:0051437 P obsolete positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
GO:0051439 P obsolete regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
GO:0051488 P positive regulation of ubiquitin protein ligase activity
GO:0090129 P positive regulation of synapse maturation
GO:0097027 F ubiquitin-protein transferase activator activity
RNA-seq EntryA_BomaASG_c28846_g1_i1
Sequence
(Amino Acid)
QAPDRILDAPEILDDYYLNLVDWSASNILAVALGNSVYLWNAGTGQIEQLLTLEGAETVC
SVGWVQGGGSHLAVGTSMATVELWDCEKIKRLRVMDGHSGRVGSLAWNMYIVSSGARDGH
IVHHDVRQRDHAVANIHGHTQEICGLKWSPDGRYLASGGNDNLLNIWPIAQGQHYSQPQH
ILSFNQHLAAVKGLAWCPWSAGILASGGGTADRTIRLWNISTGSNLNTVDTKSQVCSIVW
STHYKELISGHGYAHNQLIIWKYPTMSRVAELS
(90 a.a.)

- SilkBase 1999-2023 -