SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG1104_internal:A_BomaASG_c7450_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
semaphorin-1A_isoform_X4_[Bombyx_mori]
Ontology
GO:0001755 P neural crest cell migration
GO:0001964 P startle response
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007411 P axon guidance
GO:0007416 P synapse assembly
GO:0008039 P synaptic target recognition
GO:0008045 P motor neuron axon guidance
GO:0008201 F heparin binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016199 P axon midline choice point recognition
GO:0030154 P cell differentiation
GO:0030215 F semaphorin receptor binding
GO:0030335 P positive regulation of cell migration
GO:0031987 P locomotion involved in locomotory behavior
GO:0045499 F chemorepellent activity
GO:0045792 P negative regulation of cell size
GO:0048813 P dendrite morphogenesis
GO:0048843 P negative regulation of axon extension involved in axon guidance
GO:0048854 P brain morphogenesis
GO:0050919 P negative chemotaxis
GO:2000305 P semaphorin-plexin signaling pathway involved in regulation of photoreceptor cell axon guidance
RNA-seq EntryA_BomaASG_c7450_g1_i1
Sequence
(Amino Acid)
EQSAFNSNWLPVNNAKVPEPRPGTCHNDSRQLPDKTLNFIKTHALMDESVPAFFGEPIVI
RTSFHYRFTQIAVDPQVKTPGGKAYDVLFIGTDNGKIIKAVNAISYDSNKRAVPIVIE
(38 a.a.)

- SilkBase 1999-2023 -