SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG10981_5prime_partial:A_BomaASG_c28789_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
S-phase_kinase-associated_protein_2_[Bombyx_mori]
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000209 P protein polyubiquitination
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0008283 P cell population proliferation
GO:0016567 P protein ubiquitination
GO:0019005 C SCF ubiquitin ligase complex
GO:0031145 P anaphase-promoting complex-dependent catabolic process
GO:0033148 P positive regulation of intracellular estrogen receptor signaling pathway
GO:0042802 F identical protein binding
GO:0042981 P regulation of apoptotic process
GO:0048661 P positive regulation of smooth muscle cell proliferation
GO:0051726 P regulation of cell cycle
GO:0061630 F ubiquitin protein ligase activity
GO:0071460 P cellular response to cell-matrix adhesion
GO:1902916 P positive regulation of protein polyubiquitination
RNA-seq EntryA_BomaASG_c28789_g1_i2
Sequence
(Amino Acid)
TPSSPARRPAQPRGAAPRRCGADSFSVLSDEMILSVFRWLPKRTLAHCMLVCKRWYRIAS
DETLWQRLDLGNKAIARDALGKILDRKPVIVRLASSEVSYL
*(33 a.a.)

- SilkBase 1999-2023 -