SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG10951_5prime_partial:A_BomaASG_c28774_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
carbohydrate_sulfotransferase_11_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0001537 F N-acetylgalactosamine 4-O-sulfotransferase activity
GO:0002063 P chondrocyte development
GO:0005794 C Golgi apparatus
GO:0005975 P carbohydrate metabolic process
GO:0007585 P respiratory gaseous exchange by respiratory system
GO:0008146 F sulfotransferase activity
GO:0009791 P post-embryonic development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016051 P carbohydrate biosynthetic process
GO:0016740 F transferase activity
GO:0030204 P chondroitin sulfate metabolic process
GO:0030206 P chondroitin sulfate biosynthetic process
GO:0030326 P embryonic limb morphogenesis
GO:0030512 P negative regulation of transforming growth factor beta receptor signaling pathway
GO:0033037 P polysaccharide localization
GO:0036342 P post-anal tail morphogenesis
GO:0042127 P regulation of cell population proliferation
GO:0042733 P embryonic digit morphogenesis
GO:0043066 P negative regulation of apoptotic process
GO:0047756 F chondroitin 4-sulfotransferase activity
GO:0048589 P developmental growth
GO:0048703 P embryonic viscerocranium morphogenesis
GO:0048704 P embryonic skeletal system morphogenesis
GO:0050659 F N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase activity
GO:0051216 P cartilage development
RNA-seq EntryA_BomaASG_c28774_g1_i1
Sequence
(Amino Acid)
IIKTYRENPSNQSLEFGNDVTFKEFAMFLTNKSEELADVVNNEHWQPITDLCHPCQIKYT
LVGKYETLLDDVLLALHTIQVTGVNFPRLTSTSGTAQKLHKYYSQLDLPLIRRLYKLYKY
DFKIFDYHLDSLVGFDLD
*(45 a.a.)

- SilkBase 1999-2023 -