SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG10770_5prime_partial:A_BomaASG_c28656_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		DNA_mismatch_repair_protein_Msh2_isoform_X3_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000228 C nuclear chromosome
GO:0000400 F four-way junction DNA binding
GO:0000403 F Y-form DNA binding
GO:0000404 F heteroduplex DNA loop binding
GO:0000406 F double-strand/single-strand DNA junction binding
GO:0000710 P meiotic mismatch repair
GO:0003674 F molecular_function
GO:0003677 F DNA binding
GO:0003684 F damaged DNA binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0006281 P DNA repair
GO:0006298 P mismatch repair
GO:0006301 P postreplication repair
GO:0006302 P double-strand break repair
GO:0006311 P meiotic gene conversion
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007131 P reciprocal meiotic recombination
GO:0007283 P spermatogenesis
GO:0010165 P response to X-ray
GO:0010224 P response to UV-B
GO:0014070 P response to organic cyclic compound
GO:0016446 P somatic hypermutation of immunoglobulin genes
GO:0030983 F mismatched DNA binding
GO:0031573 P mitotic intra-S DNA damage checkpoint signaling
GO:0032137 F guanine/thymine mispair binding
GO:0032138 F single base insertion or deletion binding
GO:0032300 C mismatch repair complex
GO:0032301 C MutSalpha complex
GO:0032302 C MutSbeta complex
GO:0042493 P response to xenobiotic stimulus
GO:0042771 P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0043200 P response to amino acid
GO:0043570 P maintenance of DNA repeat elements
GO:0045128 P negative regulation of reciprocal meiotic recombination
GO:0045190 P isotype switching
RNA-seq EntryA_BomaASG_c28656_g1_i2
Sequence
(Amino Acid)
SSDLVAADYQMSVSEFTDDDLLTQLETITVQTAPSECLIPFSDNDDYKALKKVMDRTNVT
VTKLKRVDFSTEGLVQDLNRLLNFKEDQQQDANAFPETRKDLAMTSLAATIKYSALLNEN
FVCPQYERTASYTWTRRR
*(45 a.a.)

- SilkBase 1999-2023 -