SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG10737_internal:A_BomaASG_c28632_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
E3_ubiquitin-protein_ligase_RNF168_[Bombyx_mori]
Ontology
GO:0000151 C ubiquitin ligase complex
GO:0003682 F chromatin binding
GO:0004842 F ubiquitin-protein transferase activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006281 P DNA repair
GO:0006302 P double-strand break repair
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0008270 F zinc ion binding
GO:0010212 P response to ionizing radiation
GO:0016567 P protein ubiquitination
GO:0016568 P chromatin organization
GO:0016874 F ligase activity
GO:0031491 F nucleosome binding
GO:0034244 P negative regulation of transcription elongation from RNA polymerase II promoter
GO:0034644 P cellular response to UV
GO:0035518 P histone H2A monoubiquitination
GO:0035861 C site of double-strand break
GO:0036351 P histone H2A-K13 ubiquitination
GO:0036352 P histone H2A-K15 ubiquitination
GO:0042393 F histone binding
GO:0043130 F ubiquitin binding
GO:0043234 C protein-containing complex
GO:0045190 P isotype switching
GO:0045739 P positive regulation of DNA repair
GO:0046872 F metal ion binding
GO:0070530 F K63-linked polyubiquitin modification-dependent protein binding
GO:0070534 P protein K63-linked ubiquitination
GO:0070535 P histone H2A K63-linked ubiquitination
GO:1903827 P regulation of protein localization
GO:1990391 C DNA repair complex
RNA-seq EntryA_BomaASG_c28632_g1_i1
Sequence
(Amino Acid)
EEKPVTRLSLPGEIRLEYEEELQRLKAERERLEEKHIEETELLIKKIQQEEEEAHKKYIE
NLKQDEVLALKIQKEHMDNAASSTNAHTRQNQREAMKFKLKTAKIDGYLSKMKTTIIKEP
ATTASSSCNNLTPADR
(44 a.a.)

- SilkBase 1999-2023 -