SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG10736_complete:A_BomaASG_c28631_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		mitochondrial_prohibitin_complex_protein_2_[Bombyx_mori]
Ontology
GO:0000060 P obsolete protein import into nucleus, translocation
GO:0003674 F molecular_function
GO:0005575 C cellular_component
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005743 C mitochondrial inner membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007005 P mitochondrion organization
GO:0007062 P sister chromatid cohesion
GO:0008022 F protein C-terminus binding
GO:0008150 P biological_process
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016363 C nuclear matrix
GO:0031536 P positive regulation of exit from mitosis
GO:0033147 P negative regulation of intracellular estrogen receptor signaling pathway
GO:0033218 F amide binding
GO:0033600 P negative regulation of mammary gland epithelial cell proliferation
GO:0043066 P negative regulation of apoptotic process
GO:0043234 C protein-containing complex
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0047485 F protein N-terminus binding
GO:0050821 P protein stabilization
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0060744 P mammary gland branching involved in thelarche
GO:0060749 P mammary gland alveolus development
GO:0060762 P regulation of branching involved in mammary gland duct morphogenesis
GO:0070062 C extracellular exosome
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0071944 C cell periphery
GO:1902808 P positive regulation of cell cycle G1/S phase transition
RNA-seq EntryA_BomaASG_c28631_g1_i1
Sequence
(Amino Acid)
MAQSKINDMAGKFAKGGPPGLGIGLKVVAVVGAAAYGVSQSVFTVEGGHRAIMFNRIGGV
QQHVFTEGMHFRIPWFQYPIIYDIRSRPRKISSPTGSKDLQMVNISLRVLSRPDANMLAT
MYRQLGTDYDEKVLPSICNEVLKSVVAKFNASQLITQRQQVSLLIRRELVERAADFNIIL
DDVSLTELSFGKEYTAAVEAKQVAQQEAQRAAFVVERAKQERQQKIVQAEGEAEAAEMLG
KAMGMNPGYLKLRKIRAAQSISRMIAQSQNRVFLPGNSLMINLQDPTFDDLSEKLTKKK
*(99 a.a.)

- SilkBase 1999-2023 -