SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG1071_complete:A_BomaASG_c7179_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
mitochondrial_fission_1_protein_[Bombyx_mori]
Ontology
GO:0000266 P mitochondrial fission
GO:0000422 P autophagy of mitochondrion
GO:0001836 P release of cytochrome c from mitochondria
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005777 C peroxisome
GO:0005778 C peroxisomal membrane
GO:0005779 C integral component of peroxisomal membrane
GO:0005783 C endoplasmic reticulum
GO:0006626 P protein targeting to mitochondrion
GO:0006915 P apoptotic process
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0008053 P mitochondrial fusion
GO:0010821 P regulation of mitochondrion organization
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016559 P peroxisome fission
GO:0031307 C integral component of mitochondrial outer membrane
GO:0032471 P negative regulation of endoplasmic reticulum calcium ion concentration
GO:0035584 P calcium-mediated signaling using intracellular calcium source
GO:0043234 C protein-containing complex
GO:0043280 P positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043653 P mitochondrial fragmentation involved in apoptotic process
GO:0051260 P protein homooligomerization
GO:0051561 P positive regulation of mitochondrial calcium ion concentration
GO:0070584 P mitochondrion morphogenesis
GO:0090141 P positive regulation of mitochondrial fission
GO:0090314 P positive regulation of protein targeting to membrane
GO:2001244 P positive regulation of intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomaASG_c7179_g1_i1
Sequence
(Amino Acid)
MEDVLDEIVSSEDLQKFERVFHEQLHQGNVSHKAQFEYAWCLVRSKYPTDIRKGILLLKE
LFNSHPEGKRDYLFYLAIGNARIKEYNKALHYVKSFLEIEPANQQVLALERQINKRMEKE
GLIGMAVAGGAVLALGGLVGLGIALASKK
*(49 a.a.)

- SilkBase 1999-2023 -