SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG10709_internal:A_BomaASG_c28601_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		LOW_QUALITY_PROTEIN:_histone-lysine_N-methyltransferase_2C_[Bombyx_mori]
Ontology
GO:0001555 P oocyte growth
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006342 P heterochromatin assembly
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008168 F methyltransferase activity
GO:0008270 F zinc ion binding
GO:0008284 P positive regulation of cell population proliferation
GO:0016568 P chromatin organization
GO:0016740 F transferase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0032259 P methylation
GO:0033148 P positive regulation of intracellular estrogen receptor signaling pathway
GO:0035097 C histone methyltransferase complex
GO:0042800 F histone methyltransferase activity (H3-K4 specific)
GO:0043627 P response to estrogen
GO:0044212 F transcription cis-regulatory region binding
GO:0044666 C MLL3/4 complex
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048477 P oogenesis
GO:0051568 P histone H3-K4 methylation
GO:1904837 P beta-catenin-TCF complex assembly
RNA-seq EntryA_BomaASG_c28601_g1_i1
Sequence
(Amino Acid)
ALPISHTRRKRRFKNENPDKDAVVQNADVEMADDSKPDSTAEVKDEPGLPPNANFKEGTL
WNILTDGPPPEGFTVYTTDSGLTVLRRKRQRNLNKLGIGGFVVRQRQTTIKAQADEDKDG
DGTQASGESPSNKRKPRRKPRSKLMEQFPPYMQEAFFGKELLDPQVKSAVSSTGNPSESP
AGTLRPNTQIGRA
(63 a.a.)

- SilkBase 1999-2023 -