SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG10691_5prime_partial:A_BomaASG_c28587_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		programmed_cell_death_6-interacting_protein_[Bombyx_mori]
Ontology
GO:0000920 P septum digestion after cytokinesis
GO:0001772 C immunological synapse
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005737 C cytoplasm
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005925 C focal adhesion
GO:0006810 P transport
GO:0006915 P apoptotic process
GO:0006997 P nucleus organization
GO:0007049 P cell cycle
GO:0007080 P mitotic metaphase plate congression
GO:0010824 P regulation of centrosome duplication
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016032 P viral process
GO:0019058 P viral life cycle
GO:0031871 F proteinase activated receptor binding
GO:0036258 P multivesicular body assembly
GO:0039702 P viral budding via host ESCRT complex
GO:0042470 C melanosome
GO:0042803 F protein homodimerization activity
GO:0043209 C myelin sheath
GO:0046983 F protein dimerization activity
GO:0048306 F calcium-dependent protein binding
GO:0051301 P cell division
GO:0070062 C extracellular exosome
GO:0070971 C endoplasmic reticulum exit site
GO:0090611 P ubiquitin-independent protein catabolic process via the multivesicular body sorting pathway
GO:1901673 P regulation of mitotic spindle assembly
GO:1903543 P positive regulation of exosomal secretion
GO:1903551 P regulation of extracellular exosome assembly
GO:1903553 P positive regulation of extracellular exosome assembly
GO:1903561 C extracellular vesicle
RNA-seq EntryA_BomaASG_c28587_g1_i1
Sequence
(Amino Acid)
IDEPALSAAALGRALGPLQAQLAASLAAQDDLVARIQKAHGSLESGGGGAGGRDAVLGRL
AAAYDAFQDLTGNLREGVKFYNDLTQLLVAFQNKVSDFCFARKTEKEELLKDLTQEASRP
ATRPAPSPPQHHTDAVAEPSVVKKEAPPRPPPPAAAQPAALPYPSQPQGMPLPYGAPAAP
YPYYAPVPAMYNPYATLPYPHHARMPQQQYQPYQYPPPQQPYQAPPPGYNPYPQQ
*(77 a.a.)

- SilkBase 1999-2023 -