SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG10544_5prime_partial:A_BomaASG_c28495_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
dynamin-1-like_protein_isoform_X6_[Helicoverpa_armigera]
Ontology
GO:0000166 F nucleotide binding
GO:0000266 P mitochondrial fission
GO:0001836 P release of cytochrome c from mitochondria
GO:0003374 P dynamin family protein polymerization involved in mitochondrial fission
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005777 C peroxisome
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005874 C microtubule
GO:0005903 C brush border
GO:0005905 C clathrin-coated pit
GO:0006897 P endocytosis
GO:0006921 P cellular component disassembly involved in execution phase of apoptosis
GO:0008152 P metabolic process
GO:0008289 F lipid binding
GO:0010821 P regulation of mitochondrion organization
GO:0012501 P programmed cell death
GO:0012505 C endomembrane system
GO:0015630 C microtubule cytoskeleton
GO:0016020 C membrane
GO:0016559 P peroxisome fission
GO:0016787 F hydrolase activity
GO:0030054 C cell junction
GO:0030672 C synaptic vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0031625 F ubiquitin protein ligase binding
GO:0032459 P regulation of protein oligomerization
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043065 P positive regulation of apoptotic process
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0043653 P mitochondrial fragmentation involved in apoptotic process
GO:0045202 C synapse
GO:0048471 C perinuclear region of cytoplasm
GO:0050714 P positive regulation of protein secretion
GO:0051289 P protein homotetramerization
GO:0060047 P heart contraction
GO:0061025 P membrane fusion
GO:0070266 P necroptotic process
GO:0070584 P mitochondrion morphogenesis
GO:0070585 P protein localization to mitochondrion
GO:0090141 P positive regulation of mitochondrial fission
GO:0090149 P mitochondrial membrane fission
GO:0090200 P positive regulation of release of cytochrome c from mitochondria
GO:1900063 P regulation of peroxisome organization
GO:1903146 P regulation of autophagy of mitochondrion
GO:1903578 P regulation of ATP metabolic process
GO:2001244 P positive regulation of intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomaASG_c28495_g1_i2
Sequence
(Amino Acid)
GGRSDNTTVLNSNVKTVDGINVMQLNQMGDLVERLIKSYFYIVRKSIQDSVPKAVMHFLV
NFVKDNLQSELVTHLYKSDQAESMLNESEHIAQRRKEAADMLKALQRAGQIISEIRETHM
W
*(39 a.a.)

- SilkBase 1999-2023 -