SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG1052_internal:A_BomaASG_c6982_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_myosin_light_chain_kinase,_smooth_muscle-like_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0001725 C stress fiber
GO:0002230 P positive regulation of defense response to virus by host
GO:0003779 F actin binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004687 F myosin light chain kinase activity
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0006468 P protein phosphorylation
GO:0006936 P muscle contraction
GO:0006939 P smooth muscle contraction
GO:0014820 P tonic smooth muscle contraction
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0030027 C lamellipodium
GO:0030335 P positive regulation of cell migration
GO:0032060 P bleb assembly
GO:0032154 C cleavage furrow
GO:0042995 C cell projection
GO:0046872 F metal ion binding
GO:0051928 P positive regulation of calcium ion transport
GO:0060414 P aorta smooth muscle tissue morphogenesis
GO:0070062 C extracellular exosome
GO:0071476 P cellular hypotonic response
GO:0090303 P positive regulation of wound healing
GO:0098779 P positive regulation of mitophagy in response to mitochondrial depolarization
GO:0098792 P xenophagy
RNA-seq EntryA_BomaASG_c6982_g1_i1
Sequence
(Amino Acid)
LCARDAAPLLLSCAVRGDPEPAVRWYKDASPLHSSEVVDLKYKNGVASLAINEVFPEDEG
VYSLKATNSQGEVETKCIVTVKPMDTSAGSAALKAGDKPPRIVDHAVSQVVNDGDPVTLS
CRIVGAERFDVVWLHNNKEIKPSKDFQYSSEANIHKLHIAEIFPEDAGTYTCEAFNDAGE
SFSSCSVVVRVPGEAPPAPHYVAFPASLTVNATE
(70 a.a.)

- SilkBase 1999-2023 -