SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG10485_internal:A_BomaASG_c28447_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
protein_expanded_[Bombyx_mori]
Ontology
GO:0001745 P compound eye morphogenesis
GO:0001751 P compound eye photoreceptor cell differentiation
GO:0005515 F protein binding
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005915 C zonula adherens
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007050 P regulation of cell cycle
GO:0007096 P regulation of exit from mitosis
GO:0007165 P signal transduction
GO:0007275 P multicellular organism development
GO:0007298 P border follicle cell migration
GO:0007444 P imaginal disc development
GO:0008101 P BMP signaling pathway
GO:0008285 P negative regulation of cell population proliferation
GO:0009966 P regulation of signal transduction
GO:0016020 C membrane
GO:0016324 C apical plasma membrane
GO:0017124 F SH3 domain binding
GO:0030707 P ovarian follicle cell development
GO:0032456 P endocytic recycling
GO:0035329 P hippo signaling
GO:0035330 P regulation of hippo signaling
GO:0035331 P negative regulation of hippo signaling
GO:0036375 C Kibra-Ex-Mer complex
GO:0040008 P regulation of growth
GO:0042127 P regulation of cell population proliferation
GO:0042327 P positive regulation of phosphorylation
GO:0042981 P regulation of apoptotic process
GO:0045571 P negative regulation of imaginal disc growth
GO:0045595 P regulation of cell differentiation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046620 P regulation of organ growth
GO:0046621 P negative regulation of organ growth
RNA-seq EntryA_BomaASG_c28447_g1_i1
Sequence
(Amino Acid)
RTDYDESHYDCCKQAKENDLAEFDSISSILKNKAKTLNHVTNRLQVPSSDCVDGSSKYAN
QDHDKENIILFRERTNSNVSASSFHGDGSDPTDNKHNLLTASELSDLIVGRGVYPKKQSV
SDTLDSVSDYVRLPLPFSGDSYLPGHEDTAPCDDNYPNNQFFDRPPTPPTRIDSRKLLNL
SLPNILDINLDTFNKPSFPQKPPPPYEFNHRTVPLQIKTPLKDPPAYPGCSLSTLSTSLT
HLSDKEEVSARMVTSKPMITILKAEAGEVNIPCERTFASPMVLEHRFQKSKRHQASSRRA
ERSKLAQGISNLSPSREVPPPLGVDSNVFVAMMKLPPPPPPPRRSRLPPPP
(116 a.a.)

- SilkBase 1999-2023 -