SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG1045_3prime_partial:A_BomaASG_c6958_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
transcription_factor_glial_cells_missing_2_[Bombyx_mori]
Ontology
GO:0001158 F cis-regulatory region sequence-specific DNA binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006952 P defense response
GO:0007275 P multicellular organism development
GO:0007403 P glial cell fate determination
GO:0007516 P hemocyte development
GO:0008283 P cell population proliferation
GO:0010001 P glial cell differentiation
GO:0010468 P regulation of gene expression
GO:0010628 P positive regulation of gene expression
GO:0021782 P glial cell development
GO:0030097 P hemopoiesis
GO:0030182 P neuron differentiation
GO:0031290 P retinal ganglion cell axon guidance
GO:0035164 P embryonic plasmatocyte differentiation
GO:0035165 P embryonic crystal cell differentiation
GO:0035169 P lymph gland plasmatocyte differentiation
GO:0035289 P posterior head segmentation
GO:0042063 P gliogenesis
GO:0042387 P plasmatocyte differentiation
GO:0042688 P crystal cell differentiation
GO:0042690 P negative regulation of crystal cell differentiation
GO:0045610 P regulation of hemocyte differentiation
GO:0045687 P positive regulation of glial cell differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048813 P dendrite morphogenesis
GO:0050764 P regulation of phagocytosis
GO:0060252 P positive regulation of glial cell proliferation
GO:0060857 P establishment of glial blood-brain barrier
RNA-seq EntryA_BomaASG_c6958_g1_i1
Sequence
(Amino Acid)
MLGKPCPNRLCNGGRLEVQPCRGHCGYPVTHFWRHTEHAIFFQAKGSHDHPRPEAKGASE
VRRSLGAGRRVRGIALLLAREAAIADKMMTVKPEKQMSQKLVNPHSQPPPLIPDSQRVQL
TCTCGPFECSCRWRADPSSEPCMASTWPLSEAQTYTTYVPPVPPAPSLSVQQHYDPTALP
ADDIFHPEEIFQLDQPIRLDYPMEEN
(67 a.a.)

- SilkBase 1999-2023 -