SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG10243_5prime_partial:A_BomaASG_c28222_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		ubiA_prenyltransferase_domain-containing_protein_1_homolog_[Bombyx_mori]
Ontology
GO:0003674 F molecular_function
GO:0004659 F prenyltransferase activity
GO:0005739 C mitochondrion
GO:0005783 C endoplasmic reticulum
GO:0008592 P regulation of Toll signaling pathway
GO:0009234 P menaquinone biosynthetic process
GO:0012505 C endomembrane system
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016740 F transferase activity
GO:0031966 C mitochondrial membrane
GO:0035167 P larval lymph gland hemopoiesis
GO:0035204 P negative regulation of lamellocyte differentiation
GO:0035207 P negative regulation of hemocyte proliferation
GO:0043408 P regulation of MAPK cascade
GO:0045610 P regulation of hemocyte differentiation
GO:0046425 P regulation of receptor signaling pathway via JAK-STAT
GO:0046578 P regulation of Ras protein signal transduction
GO:0070584 P mitochondrion morphogenesis
RNA-seq EntryA_BomaASG_c28222_g1_i2
Sequence
(Amino Acid)
IGRASTRDLEIDCKAEIVTLAILIGRTASYLLFAFLLFIPYIMFVVASVRCSLWFLLPIL
TLPRAFEIERRFRSPDAMRYVPRQTARLNFYFGMLYMISCLFANKLPFLLR
*(36 a.a.)

- SilkBase 1999-2023 -