SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG10221_complete:A_BomaASG_c28204_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
cyclin_dependent_kinase_7_[Bombyx_mori]
Ontology
GO:0000079 P regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000166 F nucleotide binding
GO:0003713 F transcription coactivator activity
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004693 F cyclin-dependent protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005675 C transcription factor TFIIH holo complex
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0006281 P DNA repair
GO:0006283 P transcription-coupled nucleotide-excision repair
GO:0006294 P nucleotide-excision repair, preincision complex assembly
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006361 P transcription initiation from RNA polymerase I promoter
GO:0006362 P transcription elongation from RNA polymerase I promoter
GO:0006363 P termination of RNA polymerase I transcription
GO:0006366 P transcription by RNA polymerase II
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0006368 P transcription elongation from RNA polymerase II promoter
GO:0006370 P 7-methylguanosine mRNA capping
GO:0006468 P protein phosphorylation
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007050 P regulation of cell cycle
GO:0008022 F protein C-terminus binding
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0008283 P cell population proliferation
GO:0008353 F RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0030521 P androgen receptor signaling pathway
GO:0042795 P snRNA transcription by RNA polymerase II
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048471 C perinuclear region of cytoplasm
GO:0050681 F androgen receptor binding
GO:0051301 P cell division
RNA-seq EntryA_BomaASG_c28204_g1_i2
Sequence
(Amino Acid)
MEEPTLRYEKIDFLGEGQFATVYKAKDAKTDKIVAVKKIKIGSRLEAQDGINRTALREIK
LLQELQHINLIGLLDVFGQKSNVSLVFDFMDTDLEIIIKDNTIVLTPANVKAYMIMTLKG
LEYLHQNWILHRDLKPNNLLINREGILKIGDFGLAKAFGSPTRINTHQVVTRWYRAPELL
FGARQYGTGVDMWAVGCILAELLLRVPFLPGESDLDQLSRIFQVFGTPTEENWPGMKTLT
DYVQFKLFPAQELRHIFSAASEDLIFLLESLLALYPPNRCDCTQALQMAYFSSKPAPSVG
PKLPMPSNISKLEVEKPSLKRKLLDNIDGGSLAKRLQF
*(112 a.a.)

- SilkBase 1999-2023 -