SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG10177_internal:A_BomaASG_c28181_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		xanthine_dehydrogenase_[Bombyx_mori]
Ontology
GO:0003824 F catalytic activity
GO:0004854 F xanthine dehydrogenase activity
GO:0004855 F xanthine oxidase activity
GO:0005506 F iron ion binding
GO:0005737 C cytoplasm
GO:0005777 C peroxisome
GO:0005829 C cytosol
GO:0009055 F electron transfer activity
GO:0009115 P xanthine catabolic process
GO:0016491 F oxidoreductase activity
GO:0016614 F oxidoreductase activity, acting on CH-OH group of donors
GO:0016903 F oxidoreductase activity, acting on the aldehyde or oxo group of donors
GO:0030151 F molybdenum ion binding
GO:0034418 P urate biosynthetic process
GO:0043546 F molybdopterin cofactor binding
GO:0046872 F metal ion binding
GO:0050660 F flavin adenine dinucleotide binding
GO:0051536 F iron-sulfur cluster binding
GO:0051537 F 2 iron, 2 sulfur cluster binding
GO:0055114 P obsolete oxidation-reduction process
GO:0070674 F hypoxanthine dehydrogenase activity
RNA-seq EntryA_BomaASG_c28181_g1_i1
Sequence
(Amino Acid)
DRKSVAYYIPNCEVTGYVCRTNLPSNTAFRGFGGPQGMFGAENMVREIAHRLGKSPEEIS
RLNLYRENNTTHYGQVLTYCTLQRCWDECVQNSNLAERKLKIKEFNKQHRWRKRGISVIP
TKFGIAFTEKLLNQAGALVLVYVDGSVLLSHGGTEMGQGDRK
(53 a.a.)

- SilkBase 1999-2023 -