SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG10159_complete:A_BomaASG_c28158_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		DNA_repair_protein_RAD51_homolog_3_[Helicoverpa_armigera]
Ontology
GO:0000150 F DNA strand exchange activity
GO:0000166 F nucleotide binding
GO:0000400 F four-way junction DNA binding
GO:0000722 P telomere maintenance via recombination
GO:0000724 P double-strand break repair via homologous recombination
GO:0000730 P DNA recombinase assembly
GO:0000794 C condensed nuclear chromosome
GO:0003677 F DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003697 F single-stranded DNA binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005657 C replication fork
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0006281 P DNA repair
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0007066 P female meiosis sister chromatid cohesion
GO:0007131 P reciprocal meiotic recombination
GO:0007141 P male meiosis I
GO:0007283 P spermatogenesis
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0008821 F crossover junction endodeoxyribonuclease activity
GO:0010212 P response to ionizing radiation
GO:0010971 P positive regulation of G2/M transition of mitotic cell cycle
GO:0033063 C Rad51B-Rad51C-Rad51D-XRCC2 complex
GO:0033065 C Rad51C-XRCC3 complex
GO:0042148 P strand invasion
GO:0048471 C perinuclear region of cytoplasm
GO:0048476 C Holliday junction resolvase complex
RNA-seq EntryA_BomaASG_c28158_g1_i2
Sequence
(Amino Acid)
MSNYKIHTATELWQKETCLPSIPTFSQNLDHILGNGGAQLGLLTELLGLPGTGKTQLCLQ
LCASVQIPKVLSGLNAEALYIDTNTNFTPTRFKEILTASLLKCQKIEPSYLFNEEEALDR
LHYINAFGIEKFCACMNRISVFVAEHPRVKLIVIDSITFPFKEGISVQKRTGLLFRQMAD
LQRIAMEGLVAVVLVNEMSTRLGLSGGAVVGSLGDAWAHRCNKRLLLSNPSELGGSRLAL
LLKSNNAPNLVAKFQITREGIRDS
*(87 a.a.)

- SilkBase 1999-2023 -