| Name | O_BomaASG1013_internal:A_BomaASG_c6826_g1_i1 |
| Scaffold_id | |
NCBI non-redundant (nr) | serine/threonine-protein_kinase_OSR1_[Bombyx_mori] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0000287 |
F |
magnesium ion binding |
| GO:0004672 |
F |
protein kinase activity |
| GO:0004674 |
F |
protein serine/threonine kinase activity |
| GO:0004702 |
F |
obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity |
| GO:0005524 |
F |
ATP binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0006468 |
P |
protein phosphorylation |
| GO:0016301 |
F |
kinase activity |
| GO:0016310 |
P |
phosphorylation |
| GO:0016740 |
F |
transferase activity |
| GO:0023014 |
P |
signal transduction |
| GO:0035556 |
P |
intracellular signal transduction |
| GO:0046872 |
F |
metal ion binding |
|
| RNA-seq Entry | A_BomaASG_c6826_g1_i1 |
Sequence (Amino Acid) | GACDRKLNALSSYARTARLSIGTAAAGIGNLFSRKMAASTNTNTIPWSNTEDDYEIGDVI
GVGATAVVYSAYCKPRGEKCAIKRINLEKWNTSMDELLKEIQA
(33 a.a.) |