SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG10024_5prime_partial:A_BomaASG_c28071_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		exosome_complex_exonuclease_RRP44_[Bombyx_mori]
Ontology
GO:0000175 F 3'-5'-exoribonuclease activity
GO:0000176 C nuclear exosome (RNase complex)
GO:0000177 C cytoplasmic exosome (RNase complex)
GO:0000178 C exosome (RNase complex)
GO:0003723 F RNA binding
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0004527 F exonuclease activity
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006364 P rRNA processing
GO:0006402 P mRNA catabolic process
GO:0016020 C membrane
GO:0016075 P rRNA catabolic process
GO:0016787 F hydrolase activity
GO:0043488 P regulation of mRNA stability
GO:0043547 P positive regulation of GTPase activity
GO:0043928 P exonucleolytic catabolism of deadenylated mRNA
GO:0071034 P CUT catabolic process
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
GO:0090503 P RNA phosphodiester bond hydrolysis, exonucleolytic
RNA-seq EntryA_BomaASG_c28071_g1_i1
Sequence
(Amino Acid)
AGPHAALLDARRQAALADTLNYRHRHAQLAGRASVALNTHILFKNRVEIESAVVLAVKRN
ALQVLIPKYGLEGPLYLPSEKFTYNEEEHVQKCGDVVLKTFDELTVRLSLDSSNLQHRKL
VFELVEPHVPGFSYVPDARNMEVDDVAETAAPSSEKTHKKREIPAAAAPKPSKKRKSKRK
*(59 a.a.)

- SilkBase 1999-2023 -