SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG10010_5prime_partial:A_BomaASG_c28055_g1_i5
Scaffold_id
NCBI non-redundant
(nr)
dynamin_isoform_X3_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000281 P mitotic cytokinesis
GO:0001661 P conditioned taste aversion
GO:0001738 P morphogenesis of a polarized epithelium
GO:0003777 F microtubule motor activity
GO:0003779 F actin binding
GO:0003924 F GTPase activity
GO:0005525 F GTP binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005886 C plasma membrane
GO:0006897 P endocytosis
GO:0006898 P receptor-mediated endocytosis
GO:0007017 P microtubule-based process
GO:0007291 P sperm individualization
GO:0007293 P germarium-derived egg chamber formation
GO:0007298 P border follicle cell migration
GO:0007349 P cellularization
GO:0007424 P open tracheal system development
GO:0007427 P epithelial cell migration, open tracheal system
GO:0007435 P salivary gland morphogenesis
GO:0007612 P learning
GO:0007613 P memory
GO:0007614 P short-term memory
GO:0007637 P proboscis extension reflex
GO:0008017 F microtubule binding
GO:0008152 P metabolic process
GO:0008355 P olfactory learning
GO:0009408 P response to heat
GO:0016185 P synaptic vesicle budding from presynaptic endocytic zone membrane
GO:0016192 P vesicle-mediated transport
GO:0016787 F hydrolase activity
GO:0030198 P extracellular matrix organization
GO:0030536 P larval feeding behavior
GO:0030707 P ovarian follicle cell development
GO:0030866 P cortical actin cytoskeleton organization
GO:0032956 P regulation of actin cytoskeleton organization
GO:0032970 P regulation of actin filament-based process
GO:0034334 P adherens junction maintenance
GO:0035152 P regulation of tube architecture, open tracheal system
GO:0035186 P syncytial blastoderm mitotic cell cycle
GO:0036465 P synaptic vesicle recycling
GO:0040008 P regulation of growth
GO:0045202 C synapse
GO:0045747 P positive regulation of Notch signaling pathway
GO:0046667 P compound eye retinal cell programmed cell death
GO:0046843 P dorsal appendage formation
GO:0048172 P regulation of short-term neuronal synaptic plasticity
GO:0048488 P synaptic vesicle endocytosis
GO:0048489 P synaptic vesicle transport
GO:0048499 P synaptic vesicle membrane organization
GO:0050803 P regulation of synapse structure or activity
GO:0060429 P epithelium development
GO:0070864 C sperm individualization complex
GO:0072583 P clathrin-dependent endocytosis
GO:0072659 P protein localization to plasma membrane
GO:0072686 C mitotic spindle
GO:0090148 P membrane fission
GO:0098793 C presynapse
GO:1903475 P mitotic actomyosin contractile ring assembly
RNA-seq EntryA_BomaASG_c28055_g1_i5
Sequence
(Amino Acid)
AGRPAPPLPSRPGGAAPPPPAARPVPSQGLPAPLIPTRPGGASAGGAMNQLPPHMRNQIN
QAVGQAVTNAAINELSSAFARFNRPMPNMPPKLPERPQNGRPF
*(33 a.a.)

- SilkBase 1999-2023 -