BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000044-TA|BGIBMGA000044-PA|IPR012464|Protein of unknown function DUF1676 (261 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00048-8|AAB53829.1| 160|Caenorhabditis elegans Hypothetical pr... 29 3.3 >U00048-8|AAB53829.1| 160|Caenorhabditis elegans Hypothetical protein C05D11.10 protein. Length = 160 Score = 29.1 bits (62), Expect = 3.3 Identities = 23/87 (26%), Positives = 36/87 (41%), Gaps = 4/87 (4%) Query: 40 CLKNKFFSYVDKYIGQKDSFALTDGVKIYKSADVIQTGAPRSLDPLSRLKSYLETHSLSV 99 C N+F Y+ KY + F D + D + + +D SR K+ + V Sbjct: 38 CQMNEFNIYLKKYFARSFDFWALDKTSLGNIGDTVLI---KQIDGSSRPKANVSHAVDRV 94 Query: 100 EVKGTDILDAVTGAGRALQDTVTSFVD 126 K +I+D VTG + DT +D Sbjct: 95 VFKFGNIVDPVTGR-KIFNDTFADEID 120 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.315 0.129 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,426,447 Number of Sequences: 27539 Number of extensions: 146502 Number of successful extensions: 351 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 351 Number of HSP's gapped (non-prelim): 1 length of query: 261 length of database: 12,573,161 effective HSP length: 80 effective length of query: 181 effective length of database: 10,370,041 effective search space: 1876977421 effective search space used: 1876977421 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -