BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000084-TA|BGIBMGA000084-PA|IPR007012|Poly(A) polymerase, central region, IPR002934|DNA polymerase, beta-like region, IPR007010|Poly(A) polymerase, RNA-binding region, IPR011068|Poly(A) polymerase, C-terminal-like (596 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 26 0.76 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 26 1.0 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 1.3 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 24 4.1 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 24 4.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 5.4 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 26.2 bits (55), Expect = 0.76 Identities = 12/36 (33%), Positives = 19/36 (52%) Query: 450 PPGSTIPRETSPELNKNDKGEVVVNHCSMWFIGLVF 485 P IP +TS ++ + G +VN+ M F+ VF Sbjct: 547 PVAINIPGDTSIIVDSSTSGATIVNYSIMIFLSAVF 582 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 25.8 bits (54), Expect = 1.0 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Query: 462 ELNKNDKGEVVVNHCSMWFIGLVFEKTNVNVDLTYDISSFTKAVLYQAENTNMLRE 517 ++N +D+ ++ C+M +V E N N ++ DI +AVL E +L E Sbjct: 51 KINMDDENVLLFIECTMKKFNVVDENANFNEKISSDI---VRAVLNDNEADQLLAE 103 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 25.4 bits (53), Expect = 1.3 Identities = 15/48 (31%), Positives = 22/48 (45%) Query: 3 KMWPASQYSHTNTQPIKATNEYQNQQNLKTLGMTSAISTAGPKPIDIE 50 K P+S S Q QQ+++T GM I+ G KPI ++ Sbjct: 1050 KQSPSSNQSQQIQQQQLKRVVTNQQQSIQTSGMQRIIAQIGGKPIAVQ 1097 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.8 bits (49), Expect = 4.1 Identities = 26/105 (24%), Positives = 49/105 (46%), Gaps = 9/105 (8%) Query: 15 TQPIKATNEYQNQQNLKTLGMTSAISTAGPKPIDI------EKTNDLKVSL-TPFGVFES 67 TQPIK N++ T+ + AIS A PI + ++T D + T F ++ S Sbjct: 289 TQPIKYAKHKNNRRVWLTILLVWAISAAIGSPIVLGLNNTPDRTPDQCLFYNTDFIIYSS 348 Query: 68 EAEMHHRMEVLGALHRLVRQWIRDES--LRKNMPPSVADTVGGNI 110 + + ++ L+ + + +R+ + R N P++ D G+I Sbjct: 349 LSSFYIPCIIMVFLYYNIFKALRNRARKARANRKPNLGDIKPGSI 393 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 23.8 bits (49), Expect = 4.1 Identities = 11/39 (28%), Positives = 20/39 (51%) Query: 483 LVFEKTNVNVDLTYDISSFTKAVLYQAENTNMLREGLTI 521 ++F+ +V LT+D +FT+A L L G ++ Sbjct: 169 ILFDTVHVTFKLTFDNRAFTQASLAMTREEKHLPIGASV 207 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 5.4 Identities = 13/46 (28%), Positives = 19/46 (41%) Query: 549 GNKRKPDGALTHPPKKSKRLSESSNGSANGTAETPKADASTSSTIA 594 GN + HPP S L + + T T A+T++T A Sbjct: 84 GNLEQIGSRPLHPPASSTSLPATITTTTTTTTTTTATAAATATTTA 129 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.134 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,219 Number of Sequences: 429 Number of extensions: 8953 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 7 length of query: 596 length of database: 140,377 effective HSP length: 62 effective length of query: 534 effective length of database: 113,779 effective search space: 60757986 effective search space used: 60757986 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -