BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000079-TA|BGIBMGA000079-PA|undefined (169 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 26 0.23 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 25 0.40 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 25 0.40 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 25 0.52 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 25 0.52 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 25 0.52 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 25 0.52 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 25 0.52 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 25 0.52 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 25 0.52 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 25 0.52 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 25 0.52 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 25 0.52 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 2.1 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 2.8 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 22 2.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 2.8 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 3.7 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 4.9 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 4.9 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 8.5 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 25.8 bits (54), Expect = 0.23 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 5/79 (6%) Query: 89 EYSQPITNNLRGSQTSLKYDEMGSRISFQSFRSEPVQRHSVLSLPDKRGSTSSLNGRA-K 147 E+ + IT N L D R+ +Q +Q+H + G L R + Sbjct: 585 EFPRSITRNATALIKKLCRDNPAERLGYQKGGISEIQKHKWFDGFNWEG----LRARTLE 640 Query: 148 TATLPRGYGSTKESNWDEY 166 +PR +T +N+DEY Sbjct: 641 PPIMPRVQNATDTTNFDEY 659 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 25.0 bits (52), Expect = 0.40 Identities = 10/23 (43%), Positives = 12/23 (52%) Query: 59 RSDCELRRAPKPPIHSNSITNHH 81 R DC + A K H SI NH+ Sbjct: 89 RPDCFFKNAKKVTFHEMSIPNHY 111 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 0.40 Identities = 12/54 (22%), Positives = 26/54 (48%) Query: 49 KSVKRSTSFNRSDCELRRAPKPPIHSNSITNHHGPCDGSEEYSQPITNNLRGSQ 102 + + S NR++ E + PK ++NS++N++ + Y+ N + Q Sbjct: 60 RETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNNNYNTNYKKLQ 113 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.52 Identities = 12/50 (24%), Positives = 26/50 (52%) Query: 49 KSVKRSTSFNRSDCELRRAPKPPIHSNSITNHHGPCDGSEEYSQPITNNL 98 + + S NR++ E + PK ++NS++N++ + Y++ N L Sbjct: 60 RETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKL 109 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.52 Identities = 12/50 (24%), Positives = 26/50 (52%) Query: 49 KSVKRSTSFNRSDCELRRAPKPPIHSNSITNHHGPCDGSEEYSQPITNNL 98 + + S NR++ E + PK ++NS++N++ + Y++ N L Sbjct: 60 RETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKL 109 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.52 Identities = 12/50 (24%), Positives = 26/50 (52%) Query: 49 KSVKRSTSFNRSDCELRRAPKPPIHSNSITNHHGPCDGSEEYSQPITNNL 98 + + S NR++ E + PK ++NS++N++ + Y++ N L Sbjct: 60 RETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKL 109 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.52 Identities = 12/50 (24%), Positives = 26/50 (52%) Query: 49 KSVKRSTSFNRSDCELRRAPKPPIHSNSITNHHGPCDGSEEYSQPITNNL 98 + + S NR++ E + PK ++NS++N++ + Y++ N L Sbjct: 60 RETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKL 109 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.52 Identities = 12/50 (24%), Positives = 26/50 (52%) Query: 49 KSVKRSTSFNRSDCELRRAPKPPIHSNSITNHHGPCDGSEEYSQPITNNL 98 + + S NR++ E + PK ++NS++N++ + Y++ N L Sbjct: 60 RETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKL 109 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.52 Identities = 12/50 (24%), Positives = 26/50 (52%) Query: 49 KSVKRSTSFNRSDCELRRAPKPPIHSNSITNHHGPCDGSEEYSQPITNNL 98 + + S NR++ E + PK ++NS++N++ + Y++ N L Sbjct: 60 RETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKL 109 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.52 Identities = 12/50 (24%), Positives = 26/50 (52%) Query: 49 KSVKRSTSFNRSDCELRRAPKPPIHSNSITNHHGPCDGSEEYSQPITNNL 98 + + S NR++ E + PK ++NS++N++ + Y++ N L Sbjct: 60 RETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKL 109 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.52 Identities = 12/50 (24%), Positives = 26/50 (52%) Query: 49 KSVKRSTSFNRSDCELRRAPKPPIHSNSITNHHGPCDGSEEYSQPITNNL 98 + + S NR++ E + PK ++NS++N++ + Y++ N L Sbjct: 60 RETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKL 109 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.6 bits (51), Expect = 0.52 Identities = 12/50 (24%), Positives = 26/50 (52%) Query: 49 KSVKRSTSFNRSDCELRRAPKPPIHSNSITNHHGPCDGSEEYSQPITNNL 98 + + S NR++ E + PK ++NS++N++ + Y++ N L Sbjct: 293 RETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKL 342 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.6 bits (51), Expect = 0.52 Identities = 12/50 (24%), Positives = 26/50 (52%) Query: 49 KSVKRSTSFNRSDCELRRAPKPPIHSNSITNHHGPCDGSEEYSQPITNNL 98 + + S NR++ E + PK ++NS++N++ + Y++ N L Sbjct: 293 RETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKL 342 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/50 (22%), Positives = 25/50 (50%) Query: 49 KSVKRSTSFNRSDCELRRAPKPPIHSNSITNHHGPCDGSEEYSQPITNNL 98 + + S NR++ E + PK ++N ++N++ + Y++ N L Sbjct: 60 RETSKERSRNRTERERSKEPKIISNNNPLSNNYNYNNNYNNYNKHNYNKL 109 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 22.2 bits (45), Expect = 2.8 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Query: 29 EIDLEQKSKMPSITSVQ--ESPKSVKR 53 +ID +QK + SITSV SPK R Sbjct: 396 KIDEDQKCSIESITSVNSTSSPKPFPR 422 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 22.2 bits (45), Expect = 2.8 Identities = 9/42 (21%), Positives = 19/42 (45%) Query: 1 MRRSKMNINPDLGDLEEMLAHVQTQLEQEIDLEQKSKMPSIT 42 +R M + DLG + L H ++E+ + ++ +T Sbjct: 227 LRIISMQMGGDLGQVYRRLVHAVNEIEKRLLFSHNDRLGFLT 268 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 2.8 Identities = 11/50 (22%), Positives = 24/50 (48%) Query: 27 EQEIDLEQKSKMPSITSVQESPKSVKRSTSFNRSDCELRRAPKPPIHSNS 76 +Q E +++ +S Q+ P+S++ ++ RR P P + +S Sbjct: 1299 DQRAMTEARNQQQQASSQQQIPESMRSKALIDQLCRNSRRTPVPRLAQDS 1348 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.8 bits (44), Expect = 3.7 Identities = 10/34 (29%), Positives = 19/34 (55%) Query: 98 LRGSQTSLKYDEMGSRISFQSFRSEPVQRHSVLS 131 + GSQ + +GSR+ ++ S P++ +V S Sbjct: 670 IAGSQCFINIWLLGSRLDWEDHASSPLEPSAVPS 703 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.4 bits (43), Expect = 4.9 Identities = 14/65 (21%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Query: 45 QESPKSVKRSTSFNRSDCELRRAPKPPIHSNSITNHHGPCDGSEEYSQPITNNLRGSQTS 104 Q P K ++S+ C LR P + P G E +Q +T N+ ++ + Sbjct: 615 QNEPIGCKDASSY----CGLRDRKYPDARAMGYPFDRQPRAGVETLAQFLTGNMAVTEVT 670 Query: 105 LKYDE 109 +++ + Sbjct: 671 VRFSD 675 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.4 bits (43), Expect = 4.9 Identities = 10/42 (23%), Positives = 18/42 (42%) Query: 96 NNLRGSQTSLKYDEMGSRISFQSFRSEPVQRHSVLSLPDKRG 137 NN S+ KY G ++ + F +P +L ++ G Sbjct: 194 NNTELSRVGTKYHRSGGLMNVERFPYQPPFAWKILKAAEEAG 235 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 20.6 bits (41), Expect = 8.5 Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 94 ITNNLRGSQTSLKYDEMGSRISF 116 +T + +LKY E+GS + F Sbjct: 297 LTEAYSSLENTLKYYEVGSNVPF 319 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.309 0.124 0.356 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,344 Number of Sequences: 429 Number of extensions: 1970 Number of successful extensions: 21 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of query: 169 length of database: 140,377 effective HSP length: 53 effective length of query: 116 effective length of database: 117,640 effective search space: 13646240 effective search space used: 13646240 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.3 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -