BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000033-TA|BGIBMGA000033-PA|IPR013069|BTB/POZ, IPR000210|BTB (287 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 31 0.012 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 3.1 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 9.5 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 9.5 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 31.1 bits (67), Expect = 0.012 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 8/122 (6%) Query: 104 FHVSITRRFRDMYVERNTFADVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSR- 162 + SIT F ++ + + F DVT A D AHR +L A C P F+ + + + Sbjct: 14 YQSSITSAFENLRDDED-FVDVTLACDGRSLKAHRVVLSA-CSP---YFRELLKSTPCKH 68 Query: 163 -VISLPGVKIYAFHILLCYMYTDKIPSVESARCLELLELANRFCMNRLVNLVEYKVIEEL 221 VI L V H L+ ++Y ++ +V L+ A ++ L + +EL Sbjct: 69 PVIVLQDVAFSDLHALVEFIYHGEV-NVHQRSLSSFLKTAEVLRVSGLTQQADQTDRDEL 127 Query: 222 RH 223 H Sbjct: 128 SH 129 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/40 (27%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 104 FHVSITRRFRDMYVERNTFADVTFALDDGIHLAHRAILMA 143 + ++T F + ++ F DVT A ++ AH+ +L A Sbjct: 18 YQSNMTSVFHQL-LQTEAFVDVTLACNEASLKAHKVVLSA 56 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/22 (36%), Positives = 11/22 (50%) Query: 105 HVSITRRFRDMYVERNTFADVT 126 HV + R R+ Y E N + T Sbjct: 383 HVEVARLIRNYYFESNKIDETT 404 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/22 (36%), Positives = 11/22 (50%) Query: 105 HVSITRRFRDMYVERNTFADVT 126 HV + R R+ Y E N + T Sbjct: 383 HVEVARLIRNYYFESNKIDETT 404 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.324 0.139 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,783 Number of Sequences: 429 Number of extensions: 2937 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 5 length of query: 287 length of database: 140,377 effective HSP length: 57 effective length of query: 230 effective length of database: 115,924 effective search space: 26662520 effective search space used: 26662520 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.5 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -