GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA005447-TA|BGIBMGA005447-PA|IPR000101|Gamma-
glutamyltranspeptidase
         (586 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY855337-1|AAW47987.1|  510|Apis mellifera tyrosine hydroxylase ...    24   4.0  

>AY855337-1|AAW47987.1|  510|Apis mellifera tyrosine hydroxylase
           protein.
          Length = 510

 Score = 23.8 bits (49), Expect = 4.0
 Identities = 14/47 (29%), Positives = 28/47 (59%), Gaps = 4/47 (8%)

Query: 242 GSLTARLVQDIQNFGGIITEDDLRNYR---VEWQEPIAIPLTEQHTL 285
           GSL AR+++ I+NF G +T  + R  +   +++   + + +T Q+ L
Sbjct: 99  GSL-ARILKTIENFKGTVTHVESRPSKKEGLQFDVLVKVDMTRQYLL 144


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.320    0.135    0.415 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 156,527
Number of Sequences: 429
Number of extensions: 6187
Number of successful extensions: 16
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 16
Number of HSP's gapped (non-prelim): 1
length of query: 586
length of database: 140,377
effective HSP length: 61
effective length of query: 525
effective length of database: 114,208
effective search space: 59959200
effective search space used: 59959200
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 46 (22.6 bits)