GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA005409-TA|BGIBMGA005409-PA|IPR006688|ADP-ribosylation
factor
         (250 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    25   0.66 

>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 25.0 bits (52), Expect = 0.66
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 45  TLRNSVLLMGLSDSGKTLLFVRLAYSQYRQTFTSMKENIEEYITSNKTLKIVDLP 99
           TL  S +++GLS    T    R A+ + RQ+   ++  IEE  T  + L +  LP
Sbjct: 189 TLSASAMVLGLSSYSLTEFQQRRAFLETRQSL-EVQLVIEEQSTEQERLLLSVLP 242


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.136    0.387 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 71,758
Number of Sequences: 429
Number of extensions: 3153
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 250
length of database: 140,377
effective HSP length: 56
effective length of query: 194
effective length of database: 116,353
effective search space: 22572482
effective search space used: 22572482
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 43 (21.4 bits)