GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA005369-TA|BGIBMGA005369-PA|undefined
         (52 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    20   2.1  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    20   2.8  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    20   2.8  
DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein pr...    19   4.8  
DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.           19   6.4  

>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 20.2 bits (40), Expect = 2.1
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%)

Query: 7   SWPQATEPRGWAMRNVDGRLVRPW-RADKRQVRFRQCY 43
           S  Q   P+G A  N+   L  PW R+   + R RQ Y
Sbjct: 241 SQQQQAAPQGAASANLPSPLY-PWMRSQFERKRGRQTY 277


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 19.8 bits (39), Expect = 2.8
 Identities = 6/8 (75%), Positives = 7/8 (87%)

Query: 24   GRLVRPWR 31
            G +VRPWR
Sbjct: 1321 GHVVRPWR 1328


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 19.8 bits (39), Expect = 2.8
 Identities = 6/8 (75%), Positives = 7/8 (87%)

Query: 24   GRLVRPWR 31
            G +VRPWR
Sbjct: 1317 GHVVRPWR 1324


>DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein
           protein.
          Length = 486

 Score = 19.0 bits (37), Expect = 4.8
 Identities = 6/9 (66%), Positives = 6/9 (66%)

Query: 14  PRGWAMRNV 22
           P GW  RNV
Sbjct: 180 PHGWMRRNV 188


>DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.
          Length = 552

 Score = 18.6 bits (36), Expect = 6.4
 Identities = 6/13 (46%), Positives = 10/13 (76%)

Query: 40  RQCYFNPISCFRK 52
           R  +F+P+S FR+
Sbjct: 389 RTLFFHPMSSFRE 401


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.330    0.138    0.502 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,910
Number of Sequences: 429
Number of extensions: 348
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of query: 52
length of database: 140,377
effective HSP length: 32
effective length of query: 20
effective length of database: 126,649
effective search space:  2532980
effective search space used:  2532980
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 35 (19.5 bits)
S2: 35 (18.2 bits)