GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA005368-TA|BGIBMGA005368-PA|undefined
         (93 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB083010-1|BAC54131.1|  132|Apis mellifera fatty acid binding pr...    22   1.5  

>AB083010-1|BAC54131.1|  132|Apis mellifera fatty acid binding
          protein protein.
          Length = 132

 Score = 21.8 bits (44), Expect = 1.5
 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 8/47 (17%)

Query: 44 NVAPRYDRTEYEGPRTAPLRIPMDDSDMFRALYLVQKFKINEHFEED 90
          +V+P  + TE  G  T     P  ++++        KFK+ E FEE+
Sbjct: 36 SVSPVVELTENNGLYTLKTTSPFKNTEI--------KFKLGEEFEEE 74


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.321    0.139    0.416 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,043
Number of Sequences: 429
Number of extensions: 915
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 93
length of database: 140,377
effective HSP length: 48
effective length of query: 45
effective length of database: 119,785
effective search space:  5390325
effective search space used:  5390325
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.5 bits)
S2: 38 (19.4 bits)