GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA005319-TA|BGIBMGA005319-PA|IPR001950|Translation
initiation factor SUI1, IPR005873|Density-regulated protein DRP1
         (177 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride...    21   6.8  

>DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride
           channel variant 4 protein.
          Length = 489

 Score = 21.0 bits (42), Expect = 6.8
 Identities = 8/30 (26%), Positives = 17/30 (56%)

Query: 14  VTYPIKVQYCGNCSMPIEYCEYYPEYDKCK 43
           +T PIKV +  +  + ++Y + + E+   K
Sbjct: 244 ITCPIKVSWRADGQIMVDYEDEFDEFGDSK 273


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.316    0.137    0.410 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 46,494
Number of Sequences: 429
Number of extensions: 1669
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 177
length of database: 140,377
effective HSP length: 54
effective length of query: 123
effective length of database: 117,211
effective search space: 14416953
effective search space used: 14416953
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 41 (20.6 bits)