GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA005278-TA|BGIBMGA005278-PA|IPR000618|Insect cuticle
protein
         (145 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY273815-1|AAQ16156.1| 2623|Homo sapiens bone specific CMF608 pr...    29   6.0  

>AY273815-1|AAQ16156.1| 2623|Homo sapiens bone specific CMF608
            protein.
          Length = 2623

 Score = 29.1 bits (62), Expect = 6.0
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 1/65 (1%)

Query: 64   YQYQYQTSNGISGQEQGALVNEGREDASIAVQGSSGYTAPDGTPIQITYIADANGYQPSV 123
            Y+ Q + S   + Q +     + R D +I+   SSG+T P      +   A+ +  +PSV
Sbjct: 1332 YETQTERSRAQTIQREQEPQKKNRTDPNISPDQSSGFTTPTAMTPPVLTTAETS-VKPSV 1390

Query: 124  NKNTH 128
            +  TH
Sbjct: 1391 SAFTH 1395


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.310    0.128    0.364 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,621,356
Number of Sequences: 224733
Number of extensions: 675688
Number of successful extensions: 1030
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1030
Number of HSP's gapped (non-prelim): 1
length of query: 145
length of database: 73,234,838
effective HSP length: 83
effective length of query: 62
effective length of database: 54,581,999
effective search space: 3384083938
effective search space used: 3384083938
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 61 (28.7 bits)