GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA005272-TA|BGIBMGA005272-PA|IPR013099|Ion transport 2
         (376 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              23   5.6  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             22   9.9  

>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 22.6 bits (46), Expect = 5.6
 Identities = 13/49 (26%), Positives = 22/49 (44%), Gaps = 2/49 (4%)

Query: 79   QQRLLPQPTEHNQYTSFPPRSHRSPGTVKARAGDRGQYSQ--VFERVPA 125
            Q +  P P   +  T  PP  H +  +  +R+G +    Q   + RVP+
Sbjct: 1744 QFQTFPHPGNGHSGTMGPPVGHPTNASAHSRSGSQSMPRQNGRYSRVPS 1792


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 7/12 (58%), Positives = 8/12 (66%)

Query: 290 ENWSFLDAAYFC 301
           E+W  LD  YFC
Sbjct: 419 EDWKPLDKCYFC 430


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.321    0.133    0.407 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 94,335
Number of Sequences: 429
Number of extensions: 3651
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 2
length of query: 376
length of database: 140,377
effective HSP length: 59
effective length of query: 317
effective length of database: 115,066
effective search space: 36475922
effective search space used: 36475922
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 44 (21.8 bits)