GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA005253-TA|BGIBMGA005253-PA|undefined
         (193 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK131414-1|BAD18561.1|  493|Homo sapiens protein ( Homo sapiens ...    29   7.8  

>AK131414-1|BAD18561.1|  493|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16524 fis, clone OCBBF2003327, moderately
           similar to ADAM-TS 6 precursor (EC 3.4.24.-). ).
          Length = 493

 Score = 29.5 bits (63), Expect = 7.8
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 6/70 (8%)

Query: 13  GQLVQGIQGAQLLIPTSQGIATQTILTIPVNHVNSNDQMVNLALNN----GQVVSTSLAN 68
           G   + I+G  +  P S G   + ++ IP   V+   Q +NL+LN+    G   S  L  
Sbjct: 189 GSACETIEG--VFSPASPGAGYEDVVWIPKGSVHIFIQDLNLSLNHLALKGDQESLLLEG 246

Query: 69  LQAMAQPHQL 78
           L    QPH+L
Sbjct: 247 LPGTPQPHRL 256


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.312    0.124    0.335 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,300,737
Number of Sequences: 224733
Number of extensions: 436746
Number of successful extensions: 672
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 672
Number of HSP's gapped (non-prelim): 1
length of query: 193
length of database: 73,234,838
effective HSP length: 86
effective length of query: 107
effective length of database: 53,907,800
effective search space: 5768134600
effective search space used: 5768134600
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 63 (29.5 bits)